SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 263820.PTO0534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO0534
Domain Number 1 Region: 52-107
Classification Level Classification E-value
Superfamily UBA-like 0.0000023
Family CUE domain 0.091
Further Details:      
 
Weak hits

Sequence:  263820.PTO0534
Domain Number - Region: 14-63
Classification Level Classification E-value
Superfamily Synuclein 0.0392
Family Synuclein 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO0534
Sequence length 108
Comment (Picrophilus torridus DSM 9790)
Sequence
MNPREIRRMMAQMGIKSTEMSDVKQVIFKGKDKDYIIDNASVTMIEAQGQKTFQVLGNLR
EVKKEVEQYSEDDIKLVMEQAKVTREKAIEALKAANGEPAQAILNLTS
Download sequence
Identical sequences A0A1W2G1V1 Q6L1N3
WP_011177335.1.10384 WP_011177335.1.75556 263820.PTO0534 gi|48477606|ref|YP_023312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]