SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO1000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO1000
Domain Number 1 Region: 232-497
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.38e-60
Family PFOR Pyr module 0.031
Further Details:      
 
Domain Number 2 Region: 511-620
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.03e-23
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.032
Further Details:      
 
Domain Number 3 Region: 6-254
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.93e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO1000
Sequence length 631
Comment (Picrophilus torridus DSM 9790)
Sequence
MSETDINLLIGGPQGGGIDSAANMISRAFALAGYNVFGVREYHSNIKGRHSYIHYRIMKE
RPRSLKYPVDFMVALDPDTVFEHMDNVGNGTKVIYDSSFDSFELKNARMMNHDTMSRVRS
ILEEASLTPDMKGISAYLKSKGAEIYSIPFEKLITQNSVDGPATRYYNTLGAAITVAMLG
LDEDHMDDGIRYAFRGKDKVIETNLKVVKSGYDYVKSLNLKIDNLEVFERKPRLMLSGND
AVTIGKLMGGLRFQTYYPITPASDESTLLEAHEDVKLLSRENEKLKSAGVVVVQTEDELA
AVNMANGAALTGTRSATATSGPGFSLMAEGISFAGMTEIPVVVTFYQRGGPSTGLPTRNG
QADLLFALNTGHGEFPRIVISSGDVEECIYDAMKALNYAQRYQMPVIHVIDKNLANTMDL
IPTIDPKKVKLIKSEISNEKLIKRYMLDTSNGISPMGVFGRNIFWMTGDEHDELGHVTED
PFIRDRMMEKRMKKLETADSEIPLEDKAILFGDENADITYVTWGSQKGPILDAIEELKKD
GINANLLYIKMFEPFPSEFVKKVLGRARLIINVESNMTAQAAKVIRMNTGIEIENNILKY
NGRHMTLDEILKATKDIIKKNGYMVVLNNGS
Download sequence
Identical sequences Q6L0B7
WP_011177801.1.10384 263820.PTO1000 gi|48478072|ref|YP_023778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]