SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO1215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO1215
Domain Number 1 Region: 10-186
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.47e-27
Family Clp protease, ClpP subunit 0.021
Further Details:      
 
Domain Number 2 Region: 351-417
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000929
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO1215
Sequence length 418
Comment (Picrophilus torridus DSM 9790)
Sequence
MKLLLIIIIISILIFVPGIHKSQSVINHGNVLIINLTEEIDPGSSNMFHAMSKNYSAVVI
YMNTPGGILENMLQMVNCINKTEQRGIPVYTYVPDDGMAASAGSYVAMASDYIYMGSGSY
IGPSTPIVVGGTPLEENHTKNAMAALMESMAIGHKRNETAAYSMVINNTAYTSNEAYKIG
LINGICNNFTEFLKDMVHGRYIYVNENLYDQFLSFLSNPEVSGLLILIGFFAILIDLYHG
SIILSVIGITSIILGFLGAELIDASIVGIILLILGAVLMMLEFKTNHGIALLSGLLTGSL
GIYFLASPYYSSNPGYSPSPYGYNILIAIIIILILGFIFIYYISRIYLSQTRRRYTGSES
IVGQTGYSLNDIPKNGTGQVSIDGVAWEAINKGETEIKRNDEIVVLGRSGLKLIIKKH
Download sequence
Identical sequences Q6KZQ2
gi|48478287|ref|YP_023993.1| WP_011178016.1.10384 263820.PTO1215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]