SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO1360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO1360
Domain Number 1 Region: 201-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.1e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.073
Further Details:      
 
Domain Number 2 Region: 8-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 467-582
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.13e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO1360
Sequence length 583
Comment (Picrophilus torridus DSM 9790)
Sequence
MREDEVIIRIGGAAGDGVQSAGEILIRTFSRCGLYVTSYNYYQDLIRGGESWYQVRASDH
KVKNQGDGLDLLIALNKDALERHTNPDINEGGASPLEGIAIFDDGIKGYREYKNVSYCPV
PMVDIARKYSDNSLLKNTVGLGAAIAAINGDFETFAGVIRDQFGKKGEIAELNVKAAQDG
YDYFMSHYKSIKKTYKISKKPKYVIAGGASIALGAVNAGVKMYVAYPMTPASSALHFMAQ
HAKKFGVFVKMPEDEISAINTIIGANYAGIRAMTGSSGGGFALMTEAVGLAGMTEVPAVI
YEAQRPGPSTGLPTKTEQGDLNQVLGASQGDFPRIVLAPRNVEEAFYTVQEAFNLADKYQ
CPVFVISDLYLSEHYDTVDKLNLDYPIDRGYIVKEAENYKRYEFTENGISPRALPGTPKL
MHNEDSDEHDEYGNVVSDAITDPVIRSRMVEKRMRKLEDYKKSIPGTETYKLDDAEYAVI
LWGSTQGAVEEAIDILRSNGIKIGAIEPTHIYPLNEDIKELVKNKKLVFTVENNYSGQFR
RLLRAELLIDSIGINKYNGEAFYPGEIVKEISKFILEEKNIME
Download sequence
Identical sequences Q6KZA7
263820.PTO1360 WP_011178161.1.10384 gi|48478432|ref|YP_024138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]