SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO1507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO1507
Domain Number 1 Region: 32-101
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000549
Family NfeD domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO1507
Sequence length 102
Comment (Picrophilus torridus DSM 9790)
Sequence
MVSQQVAIELILDAVVFFFIGAWFSRFYLRHPFRRKPVTGKDAMIGKTGIVVNITKNNFY
EVSVDSEIWRALPLEKNDKFQKGDEVIIKDIRSLVLYIQKIK
Download sequence
Identical sequences A0A1W2G2B2 Q6KYW0
WP_011178308.1.10384 WP_011178308.1.75556 263820.PTO1507 gi|48478579|ref|YP_024285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]