SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A0853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_A0853
Domain Number 1 Region: 45-225
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.78e-26
Family Clp protease, ClpP subunit 0.032
Further Details:      
 
Domain Number 2 Region: 396-460
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000562
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A0853
Sequence length 472
Comment (Ralstonia eutropha JMP134)
Sequence
MRFAIARLAHPWLYVGLLLAGFALAVLGAAPTASVPAGTVAGTAPVYVIPLKGAIGPASA
SFVLRGMERAREGGAQLVVLEMDTPGGLDLSMREIIQAILASPVPIASYVFPGGARAASA
GTYILYASHIAAMAPGTNLGAASPVQIGIGGPQKPEAAPASSPASEPAAQDTMTRKQMHD
ASAYIRGLAQLRGRNAHWAERAVREAVSLSATEAATQRVVDMVATDLPDLLRKVNGKRIT
AAGVERVLQTDRATVVTLEPDWRSRFLAVITEPSVALLLMMIGIYGLIFEFSTPGMVVPG
VAGAICLLIGLFALQMLPVNYAGLALIALGIGCMVAELFLPSFGTLGVGGIVAFAFGAVM
LIDTDVPGFGVPIGLIAALSAVSALFLFGMSALLLRARRRPVVSGADTLVGSRGEVLDDL
QDEGWAMVRGEQWRIRSARPLARGTPVIVTAREGLLLDVVSAPEIPPARQPT
Download sequence
Identical sequences Q474F1
264198.Reut_A0853 gi|73540556|ref|YP_295076.1| WP_011297037.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]