SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_C6218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_C6218
Domain Number 1 Region: 745-985
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.32e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 28-209
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000706
Family Pyruvate oxidase and decarboxylase Pyr module 0.079
Further Details:      
 
Domain Number 3 Region: 454-638
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000746
Family PFOR PP module 0.038
Further Details:      
 
Weak hits

Sequence:  264198.Reut_C6218
Domain Number - Region: 288-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0104
Family Transketolase C-terminal domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_C6218
Sequence length 1176
Comment (Ralstonia eutropha JMP134)
Sequence
MNQRANDNHFLTDENYRLEDRYLRASGRVFLTGTQALVRILLEQARADRVAGLHTGGLVS
GYRGSPLGGLDQELWRQRKMLAEHDIRFEPGLNEDLGATMLWGAQQIDAFPGKRVEGVFS
MWYGKGPGVDRTGDVFRNANILGTSRHGGVLAIAGDDHAAQSSMFPHQTDHVFEGAMMPI
LFPSSVEEYIEFGLFGYALSRFSGLWVAFKAITETVESGRSMTLPGSGLGRGFGIPTDIE
IPERGFGLDTAIRWPAERAELERRLIEERLPAALAFARANPIDRTVIRPAIAKVGIITVG
KAHLDVMAALRRLDLDTAALEFLGIGIYKVGMSWPLEGKGVECFCAGMQALIVVEEKRSM
VEQQIQTLLYNHAAQDRPAVYGKHGPDGEKWLPATMEFSPEQVAGVLRRFFGAQGIVATE
ARGTQRSGADAGGSSRMIPIHPAEQVLSRKPFFCSGCPHNNSTRLPDGSYAAAGIGCHIM
ALGQRDRTATFCQMGGEGVQWVGLSTFSKMPHLFVNLGDGTYQHSGSLAIRQAVAAGTAV
TYKILFNDAVAMTGGQPTEGGLTVPKIAAQLVAEGVKEIVVVSEEPARYRSISEMPANVA
VVNRSELDTVQRRLREYPGVSAIIYDQTCAAEKRRRRKRGSLATPKRHIAIHPAVCEGCG
DCSARSGCIAVEPLETELGRKRIVNQSACNKDMTCVQGYCPSFVTIEGERASSVQSGTLR
RLEAEWGLALPPPASTSPELLQHCGVLVAGIGGTGIVTVGAILAMAAHLEGRGASTLDFT
GLAQKNGAVVSHIQLAESPAHIATARIEPKSANLLLGCDAVVAASPDVLARLRPGSAHAV
VETAMTPTADFVGDGDMQLSLPAHRHAIERAIGEGRAEFHDWSAAAQTIFGDTFAANLML
VGHAFQRGWLPVSEIAIQRAIELNGASVEANRRAFLWGRILAHDPTALQKAGQADIAASE
PFTIGGFVGARAQELAAYQNAAYGRRYAVLVDRVARAEGQISDAPGVLTEGVARNYFKVL
AYKDEYEVARLHTDPVASRAMMQGFAPGAKRVFHMAPPILARSGGPGGMRRKIALKGWFI
VPLMHVLRHGKVLRGTVLDPFGLQADRQLERRLITEFERDVDAVLERLSPKTLDDAVALV
RLYEKVRGFGHIKMRHFDDARSEFERLREKLGRSEG
Download sequence
Identical sequences Q46MU8
gi|72384030|ref|YP_293384.1|NC_007336 gi|72384030|ref|YP_293384.1| 264198.Reut_C6218 WP_011295969.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]