SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264199.stu0635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264199.stu0635
Domain Number 1 Region: 139-432
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.21e-128
Family Enolase 0.000000000181
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.08e-57
Family Enolase N-terminal domain-like 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264199.stu0635
Sequence length 434
Comment (Streptococcus thermophilus LMG 18311)
Sequence
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKARYG
GLGTQKAVDNVNNVIAEHIIGFDVRDQQGIDRAMIALDGTPNKGKLGANAILGVSIAVAR
AAADYLEVPLYSYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMIVPAGAPTFKEALR
WGAEIFHALKKILKERGLETAVGDEGGFAPRFDGTEDGVETIIKAIEAAGYVPGKDVFIG
LDCASSEFYDAERKVYDYTKFEGEGAAVRTAAEQIDYLEELVNKYPIITIEDGMDENDWD
GWKALTERLGDKVQLVGDDFFVTNTAYLEKGIAEHAANSILIKVNQIGTLTETFDAIEMA
KEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEV
AEYRGLKSFYNLKK
Download sequence
Identical sequences Q5M0M5 Q5M561
WP_011225708.1.14318 WP_011225708.1.20409 WP_011225708.1.56630 WP_011225708.1.70431 WP_011225708.1.92232 WP_011225708.1.92807 264199.stu0635 299768.str0635 gi|55820714|ref|YP_139156.1| gi|55822605|ref|YP_141046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]