SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264201.pc1738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc1738
Domain Number 1 Region: 89-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000432
Family NfeD domain-like 0.0084
Further Details:      
 
Weak hits

Sequence:  264201.pc1738
Domain Number - Region: 22-71
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0458
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264201.pc1738
Sequence length 159
Comment (Parachlamydia sp UWE25)
Sequence
MIASIFLLCGLALIFIEFYIPGAIMGVLGSIFLIASIIVFTSQINSIWATIFYIFFTFSC
VVLLIRFTLWRIVHTRQEYSIYLKKDQKGFQASEYDRNAIGKLGMVLTDLKPGGYILIDG
EQHQAISLTGYISKGEEVVVVSGQEESLIVKNLFPTQTI
Download sequence
Identical sequences Q6MAD7
264201.pc1738 gi|46447372|ref|YP_008737.1| WP_011176283.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]