SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264202.CF0051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264202.CF0051
Domain Number 1 Region: 142-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.12e-118
Family Enolase 0.0000000489
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.53e-51
Family Enolase N-terminal domain-like 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264202.CF0051
Sequence length 424
Comment (Chlamydophila felis Fe C-56)
Sequence
MLEVAISDIQAREILDSRGYPTLYVKVITDAGTFGEACVPSGASTGIKEALELRDHDTSR
YQGKGVLQALNNVKEVLLPVVQGVNIFDQILIDSIMVEADGTPNKEKLGANAILGISLAA
AKAAAATLGQPFYRYVGGCFSHVLPCPMMNLINGGMHANNGLQFQEFMIRPIGATSIKEA
VRMGADVFHTLKKLLNDKNLATGVGDEGGFAPQLKSNSEALDLLVLAIEKSGFQPGKEIS
LALDCAASSFYDTKTKTYEGKSYQEQVEILADLCDRYPIDSIEDGLAEEDFDGWDLLTAE
LGDAIQIVGDDLFVTNPELIAEGISKGRANAVLIKPNQIGTLTETSEAIQLAHNQGYTTI
LSHRSGETEDTTIADLAVAFNTGQIKTGSLSRSERIAKYNRLMAIEEELGPVGLFKDSNP
FSGE
Download sequence
Identical sequences Q256G5
264202.CF0051 gi|89897858|ref|YP_514968.1| WP_011457608.1.63481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]