SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264202.CF0157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264202.CF0157
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.69e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264202.CF0157
Sequence length 110
Comment (Chlamydophila felis Fe C-56)
Sequence
MDWLTKQYRDVLVVSLEGALDAVSVPQAEAFLDKKVQEGKHKIVLNFQYVTYMSSAGIRL
LFSLSKSLQACQGLLCVCCVSDAVAEVIRIAGVDQLLPVCQSEQECFTKF
Download sequence
Identical sequences Q255V9
WP_011457714.1.63481 gi|89897964|ref|YP_515074.1| 264202.CF0157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]