SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264462.Bd3465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264462.Bd3465
Domain Number 1 Region: 140-249
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-26
Family cAMP-binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 10-143
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000171
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264462.Bd3465
Sequence length 253
Comment (Bdellovibrio bacteriovorus)
Sequence
MGRNDQKKNTFLIISGDKTRIHKCTDTLNRNFENCSVFHGSEWFEAKYKLDNVHPKAVLV
DEYLPKGSGFDIVAKILKEKNNDDIAIIIMSYVADHDIFKHEVASGRIQFLTEPDREKAL
VDCVSKIISPKVDSNQAQYELKQLQPGDVLFKEGDMTEVAYIVKKGSLRAYSEGPDGEKI
MFGEILPGEFVGEMGHFNHEPRSATVEAITEVELIAIPNGSLDNVIFARPSWAKALVKTL
SLRLKKANKALTG
Download sequence
Identical sequences Q6MHS5
264462.Bd3465 gi|42524818|ref|NP_970198.1| WP_011165795.1.10133 WP_011165795.1.54414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]