SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264730.PSPPH_0274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  264730.PSPPH_0274
Domain Number - Region: 419-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00353
Family Anti-sigma factor antagonist SpoIIaa 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264730.PSPPH_0274
Sequence length 505
Comment (Pseudomonas syringae phaseolicola 1448A)
Sequence
MKTALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIVGGLIVGWIAGSPLQVSG
PAAGLAVLVFEVVREHGMAMLGPILVLAGLLQLLAGRFKLGCWFRVTAPAVVYGMLAGIG
VLIVLSQAHVMFDSSPKPSGLDNLIAFPSTLIQAFGPGTGMQAGMLGLGTMLIMWGWEKL
RPQSLRFVPGALLGVGIATGISLFMALQVKRVEVPDNLADAIDWLRPTDLMNLADPAILV
AAIVVAFIASAETLLSASAVDRMHSGQRSDFDKELSAQGVGNMLCGVLGALPMTGVIVRS
SANVQAGATTRFSTIFHGLWLLAFVLLLSSVLQSIPVASLAGVLVYTGLKLVDLKAFRGL
GRYGRMPMFTYAATAVAIIFTDLLTGVLVGFGLTLVKLAFKASRLKINVVELAGEKEFEL
RLVGAATFLKVPALTQALGTIPQGSTVHVPLGNLSYIDHSCLELLEEWGRSNAAHGTRLL
IEPHGLKRRLEGRIYTTTGIGSGAA
Download sequence
Identical sequences Q48PU0
264730.PSPPH_0274 gi|71736843|ref|YP_272579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]