SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264730.PSPPH_0993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264730.PSPPH_0993
Domain Number 1 Region: 13-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.16e-47
Family GHMP Kinase, N-terminal domain 0.000000939
Further Details:      
 
Domain Number 2 Region: 167-285
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.23e-32
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264730.PSPPH_0993
Sequence length 288
Comment (Pseudomonas syringae phaseolicola 1448A)
Sequence
MTALQDMAKAQLVLPAPAKLNLMLHILGRRPDGYHELQTLFQFLDYGDELGFTVREDGEI
RLQTDVPGVPHDSNLIVKAARALQKQSGCTLGMDIWLEKRLPMGGGIGGGSSDAATTLLA
LNHLWQLGWDEDRLAQLGLTLGADVPVFVRGHAAFAEGVGEILTPVDPEEPWYLVLVPQV
AVSTAEIFSDPLLTRDTPPIKVRPVPKGNSRNDCKAVVERRYPEVRNALNLLGNFTEAKL
TGTGSCVFGAFPNKAEADKVSALLTETLTGFVAKGSNISMLHRKLQIL
Download sequence
Identical sequences Q48MV8
gi|71737559|ref|YP_273264.1| 264730.PSPPH_0993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]