SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_0035
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0035
Sequence length 190
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MPLNIKIALAGEGGQGVQSIAEILTEAAYRAGHQALYIPNFGVEQRGGVSVAFVQVSEQP
VSAPKFTTGDIVVALSYRAVERVKQYTGAATTLVYDASLEDEVRKVYGDKPGKLAVPALE
IAQKEMHPRVFNVIILGVLVGLTGFLKQQEVKEALERQLGHKFAQDPSLRDLNYRALERG
YQLVSRREAQ
Download sequence
Identical sequences A0A0S6UEF7 A0A1D7X6J8 Q2RMG4
WP_011391584.1.24029 WP_011391584.1.35666 WP_011391584.1.46409 WP_011391584.1.52901 WP_011391584.1.79026 WP_011391584.1.90723 YP_428918.1.14147 gi|83588909|ref|YP_428918.1| 264732.Moth_0035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]