SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_0376
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.02e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0376
Sequence length 182
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MLQLKLYGLGGQGVVTAAKVLASAIAIQEGRYAQAVPAYGHERRGAPVYADLIVDDEPIL
VKSFVYQPDYVLIFDLAVIEKGVNVTEGAHKNTCFVANSDKAPIEYPFSQGFGPVYYADA
TKIALEVLNIEIPNSAMLGAFAATGVVKIDSVCAALQEFFQGKAGDKNVEAARRCYTSIQ
RL
Download sequence
Identical sequences A0A1J5NHF6 Q2RLH9
gi|83589244|ref|YP_429253.1| WP_011391919.1.11833 WP_011391919.1.17212 WP_011391919.1.24029 WP_011391919.1.52901 WP_011391919.1.87131 WP_011391919.1.90723 YP_429253.1.14147 264732.Moth_0376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]