SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_0391
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0391
Sequence length 109
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MLTIEVTRVNDSRCLNLKGELDMETLPMLERMAEAREGEGRLIINLSGVSFIDSTGLRGL
LTIQQEWAAKGGRVHFLNPCPEVAEVFRLVGLEELLQGTSGEMVEAGEN
Download sequence
Identical sequences A0A1D7X7A9 Q2RLG4
264732.Moth_0391 WP_011391932.1.11833 WP_011391932.1.24029 WP_011391932.1.35666 WP_011391932.1.46409 WP_011391932.1.52901 WP_011391932.1.79026 WP_011391932.1.87131 WP_011391932.1.90723 YP_429268.1.14147 gi|83589259|ref|YP_429268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]