SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_0393
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0393
Sequence length 109
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MSGLEVSVHREKDRSVLRVAGELDFSNINQLQQEIERQDTKIVEIDCSALQFMDSSGAGL
LLSIARVLNLQNRILEITHIPEHIYHDLDIIGVFRVLESFKASRPTGGN
Download sequence
Identical sequences A0A1J5NBA9 Q2RLG2
WP_011391934.1.24029 WP_011391934.1.52901 WP_011391934.1.90723 YP_429270.1.14147 gi|83589261|ref|YP_429270.1| 264732.Moth_0393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]