SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_1043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_1043
Domain Number 1 Region: 263-355
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000111
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0000000459
Family D-glucarate dehydratase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_1043
Sequence length 359
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MPGRRRPTRRIQVGKVAIGGGAPISVQSMTNTDTRDITATVAQIRRLAAAGCEIVRLAVP
DQEAALALAKIKAQVEIPLIADIHFDYRLALAALEAGVDGLRLNPGNIGGPERVKAVVKE
AAARRVPIRIGVNAGSLEKEVLAAHGGVTAEAMVASALKHIRLLEDLDFREIKVSLKASE
VPLMLAAYRLMAEKVDYPLHLGVTEAGRGLEGAVKSAVGIGILLAEGIGDTIRVSLTGDP
VQEVIAGFAILRALGLRQQGIELISCPTCGRCQLDLDAVAARVQEELRGIKQPLKVAIMG
CAVNGPGEARQADVGIAGGPGFGLLFRHGRPVRKVKEEDLARALVEEVKRLAAERREQG
Download sequence
Identical sequences Q2RJN2
gi|83589891|ref|YP_429900.1| 264732.Moth_1043 YP_429900.1.14147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]