SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_1498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_1498
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.29e-26
Family Anti-sigma factor antagonist SpoIIaa 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_1498
Sequence length 113
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MQVFFSMEGKELQARIKGEVDLETADQLRQELEASLDHARPEVLLLDLAGVTFMDSSGLG
VILGRYRRLQKKGGRIILYRPQPQVRRLLELSGLGKIMTIETGEGLSEQGEID
Download sequence
Identical sequences A0A1J5N6D9 Q2RID2
gi|83590341|ref|YP_430350.1| 264732.Moth_1498 WP_011393007.1.24029 WP_011393007.1.52901 WP_011393007.1.64341 WP_011393007.1.87131 WP_011393007.1.90723 YP_430350.1.14147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]