SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_2276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_2276
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.89e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_2276
Sequence length 192
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MSNDVLNVLLVGVGGQGTILAGRVLSRAAISLGGEVKVSDIHGMAQRGGSVVTQVRFGPR
VYAPVIAPGTADFLVAFEKLEARRWLPYLKAGGCLIVNDQEMPPLPVLTGAATYPADLVA
VMGKLVQNLVVLDALDLARRAGNVKTVNMVLMGALARRLSISREAWEEALAASVPERFLE
VNKKAFNLGWEQ
Download sequence
Identical sequences A0A1D7XEB5 Q2RG76
2005299622 gi|83591097|ref|YP_431106.1| WP_011393759.1.11833 WP_011393759.1.15954 WP_011393759.1.17212 WP_011393759.1.35666 WP_011393759.1.46409 WP_011393759.1.52901 WP_011393759.1.64341 WP_011393759.1.79026 WP_011393759.1.90723 YP_431106.1.14147 264732.Moth_2276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]