SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 265072.Mfla_0087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265072.Mfla_0087
Domain Number 1 Region: 75-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000654
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 265072.Mfla_0087
Sequence length 150
Comment (Methylobacillus flagellatus KT)
Sequence
MLEPFWIWGILGLVLIALEMLSSTLYILWFGIAALCLALLTYLLPALGIAWQLLIFAALS
LGSLAVWKQFYRREKNNFNIGQSRSDEIGRTGIIIEPVSPRQNGMIEFAQGVLGSRRWEA
VASEEIEAGAEAVIVAVEGNRLRVSRKTAH
Download sequence
Identical sequences Q1GXF0
265072.Mfla_0087 gi|91774443|ref|YP_544199.1| WP_011478455.1.99167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]