SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 265072.Mfla_0241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265072.Mfla_0241
Domain Number 1 Region: 20-78
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000141
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 265072.Mfla_0241
Sequence length 85
Comment (Methylobacillus flagellatus KT)
Sequence
MTINQVNVLLAESRALQMPSVLEVDLAQVAEVDTVALSLIFEWMRHAAANKVDIRVVNLP
ANLVGLATLYGVLELIPQSDSSHYH
Download sequence
Identical sequences Q1H4S5
265072.Mfla_0241 gi|91774597|ref|YP_544353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]