SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 265072.Mfla_0799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  265072.Mfla_0799
Domain Number - Region: 431-499
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000746
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 265072.Mfla_0799
Sequence length 519
Comment (Methylobacillus flagellatus KT)
Sequence
MTTQTNTVEVKAGSFSRDFFASIVVFLVAVPLCLGIAIASGLPPTAGIITGIIGGLVVGS
ISGSPLTVSGPAAGLVVIVADIVAEFGLAIYGVIVLAAGLVQILAGVFKLGVWFRAISPA
VIHGMLGGIGILIIGSQFHIMLDRDPLSSGIANLIDIPNGLLETFESHGGNIYAAITGII
TIVAIVLWTRFAPAKLKLIPGALIGVVLAVIVANLFNFDIKYLTDLFDGPTDLQNILGTI
ITPTMSTIEASMTTGVLLAVVSLAFIASAESLLSCAAVDQMHQGVRTKYDRELMAQGVGN
AICGFLSALPMTGVIVRSSANVEAGATSRVSTILHGLWLLLFISVFLFTLEYIPVATLAG
VLVYTGYKLAYPKVAKELLSYGKAELAIYIITIVTIVSFNLLAGVVTGLVLSIAKLLYVF
SHVSIKAEHQPDSKQTTLHLKGSATQLGIPKLVSVLDHLEPGREIHVLFDDLEYIDHACI
QLLDGWQKQYQMTGGKVIIEWDSLIGKYHARETAIAEGN
Download sequence
Identical sequences Q1H370
265072.Mfla_0799 gi|91775152|ref|YP_544908.1| WP_011479164.1.99167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]