SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 265669.LMOf2365_0846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265669.LMOf2365_0846
Domain Number 1 Region: 788-1183
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.88e-127
Family PFOR PP module 0.00000000499
Further Details:      
 
Domain Number 2 Region: 415-663
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-78
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000182
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.59e-73
Family PFOR Pyr module 0.000000047
Further Details:      
 
Domain Number 4 Region: 259-405
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.36e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000332
Further Details:      
 
Domain Number 5 Region: 668-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-20
Family Ferredoxin domains from multidomain proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 265669.LMOf2365_0846
Sequence length 1215
Comment (Listeria monocytogenes 4b F2365)
Sequence
MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWSSKNKKNLFNEPVKVVEM
QSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELLPTVFHVSARTISAASL
NIFGDHSDVMAARQTGFAMLAEGSVQEVMDLSAVAHLASLKGSLPFLNFFDGFRTSHELQ
KVEVLEYDELENLLDKEALQQFRNRAMTPNNPKTLGSNQNPDIFFQQRETVNRYYEEIPN
IVQNYMKEINQLRGTDYDLVNYYGAEDATDVIVAMGSVTPVIEQVIDYLTTQGKKVGLLN
IRLYRPFPAENFLAKLPKTVERVAVLDRTKEPGSGGEPLLLDVQSVLYDSETRPLVIGGR
YGLGSKDVTPDQILGVYSHLTTEKPKPRFTIGITDDITNLSIENAGPSDLTSEKTFQCKF
WGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKSGGLTVSHLRFGEKRIRSAYLIQ
QADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGEQLERHLPAAMREYIAKNNIQFYT
LNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKESAIATYGKKDMAVAEKNI
LAMDQTVANLHKVEVPASWANPVVTAETNATTEKPAYVQNILEPVNRLEGDNLTVGDLIS
NGMVSGAYPPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRPILTDEEEMESA
PEGFMTREMRGKDGLRYRIQVSPMDCTGCNLCAETCPAKDKALVMKPFEEVAAKENPNWS
FAINVKPKKNPGKKNTVPGSQFEQPLLEFSGACAGCGETPYVKLLTQMFGDRMMIANATG
CSSIWGASAPATPYTVNDKGHGPAWGNSLLEDNAEYGYGMYLANQTMRKALNNKVTKALR
EEAMSETLREALIDWQTQMDVSEDTRERAEALQLALLSEMEGNAALESIYNDRELFIKRS
QWMLGGDGWAYDIGFSGIDHVLASGEDVNIFVMDNEVYSNTGGQSSKATPTAAIAKFASG
GKSVGKKDLGIMAMSYGNIYVAQIAMGANKRQTLKAIEEAEAYPGPSLIIAYTPCINHGI
SSGMKTMLSETQKAVECGYWSLYRYNPALEEKGKNPMTMDYKKVDFDQFEDFLKRETRYS
ALYKANPDVATKLSEKTRLDAEKRFKRYATMAGLDLEKIWKKKEATEDVKAPVDDERAAR
KAAREARRLAREQGK
Download sequence
Identical sequences A0A0E1RB19 A0A2J9G573
gi|405752047|ref|YP_006675512.1| 265669.LMOf2365_0846 gi|424713707|ref|YP_007014422.1| WP_010958813.1.10210 WP_010958813.1.102150 WP_010958813.1.11689 WP_010958813.1.12020 WP_010958813.1.12993 WP_010958813.1.13004 WP_010958813.1.13360 WP_010958813.1.13855 WP_010958813.1.14875 WP_010958813.1.16516 WP_010958813.1.1678 WP_010958813.1.1688 WP_010958813.1.17106 WP_010958813.1.18289 WP_010958813.1.19112 WP_010958813.1.19246 WP_010958813.1.19452 WP_010958813.1.19472 WP_010958813.1.19584 WP_010958813.1.20263 WP_010958813.1.20672 WP_010958813.1.21874 WP_010958813.1.22188 WP_010958813.1.22221 WP_010958813.1.233 WP_010958813.1.23781 WP_010958813.1.23828 WP_010958813.1.24847 WP_010958813.1.24934 WP_010958813.1.25896 WP_010958813.1.27860 WP_010958813.1.28818 WP_010958813.1.29558 WP_010958813.1.29562 WP_010958813.1.29569 WP_010958813.1.31329 WP_010958813.1.32061 WP_010958813.1.32140 WP_010958813.1.32597 WP_010958813.1.35452 WP_010958813.1.36108 WP_010958813.1.36749 WP_010958813.1.37466 WP_010958813.1.37723 WP_010958813.1.37951 WP_010958813.1.39496 WP_010958813.1.40556 WP_010958813.1.41222 WP_010958813.1.42525 WP_010958813.1.42994 WP_010958813.1.43916 WP_010958813.1.44092 WP_010958813.1.44749 WP_010958813.1.45778 WP_010958813.1.4587 WP_010958813.1.45893 WP_010958813.1.46566 WP_010958813.1.47001 WP_010958813.1.47075 WP_010958813.1.48007 WP_010958813.1.48175 WP_010958813.1.48854 WP_010958813.1.49458 WP_010958813.1.51493 WP_010958813.1.54506 WP_010958813.1.54884 WP_010958813.1.5671 WP_010958813.1.58966 WP_010958813.1.59542 WP_010958813.1.60543 WP_010958813.1.60674 WP_010958813.1.61274 WP_010958813.1.63209 WP_010958813.1.64587 WP_010958813.1.64796 WP_010958813.1.66285 WP_010958813.1.68517 WP_010958813.1.70100 WP_010958813.1.70736 WP_010958813.1.71904 WP_010958813.1.72623 WP_010958813.1.72813 WP_010958813.1.74148 WP_010958813.1.74823 WP_010958813.1.77261 WP_010958813.1.77594 WP_010958813.1.77675 WP_010958813.1.77849 WP_010958813.1.78088 WP_010958813.1.79821 WP_010958813.1.80693 WP_010958813.1.81315 WP_010958813.1.84895 WP_010958813.1.84974 WP_010958813.1.85317 WP_010958813.1.87294 WP_010958813.1.88463 WP_010958813.1.88783 WP_010958813.1.88800 WP_010958813.1.90857 WP_010958813.1.92288 WP_010958813.1.93421 WP_010958813.1.93534 WP_010958813.1.93558 WP_010958813.1.94554 WP_010958813.1.96751 WP_010958813.1.97803 gi|46907060|ref|YP_013449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]