SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_2639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_2639
Domain Number 1 Region: 150-269
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000284
Family Histidine kinase 0.022
Further Details:      
 
Domain Number 2 Region: 36-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000353
Family Anti-sigma factor antagonist SpoIIaa 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_2639
Sequence length 303
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
METMLRLDVRRRGAMSGVLTLGSLDPAFAGCAGLSGEPVVLDLRSVEFVEPAGLCGLAAL
LEHAIPRSEEVVLLLAGHDVPAYLERMNFFRLFGGRVRTNIDVAPLQERRRHNPGTLQEL
VNFHDEGEIPAIIERISEILQNQGYLLKERVAICSTLSEICANAAEHGASSFGAYAAVQA
YHHIVSGARRRGEEVLVAIADGGVGVRKTLSRNPAHARYTTTDNDALRHALKMGVSATGE
LGRGGGLTLVAQKAAAAGGSLSIRSGSGRITVYRNRKSSRNVPPFPGTFVRVSLPRHLPP
ERA
Download sequence
Identical sequences Q1ASS2
266117.Rxyl_2639 WP_011565565.1.70533 gi|108805431|ref|YP_645368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]