SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_2892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_2892
Domain Number 1 Region: 97-298
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-45
Family D-glucarate dehydratase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.0000000000000126
Family Enolase N-terminal domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_2892
Sequence length 325
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MLLRLEAEGASGWGEAAPLSGFSRETPAQAARALQKVLPGLLGLDLEEARLPRGGLPPSA
RFALELALLGARAAASGRPLPELLSPSPQPEVEVSALLSGPPETVLEEARRMRAAGYRAF
KLKVGGRPVEEDVRLVRSLGEELGGSVTLRLDANRAWEFPEALRFAAAGLRFLYVEEPLR
DPAGLPELVRRGNLPVALDESLFGMEPEGLAGHRYARAAVLKPTLLGGLSRTLRFARAAR
ELGMEVAVSSAYESGVGTLGLLALAAACGAPAGLDPYRSLARDVLRPRPALAAPRLVVGA
AFSARRAVAREALEELLGDAGGGGE
Download sequence
Identical sequences Q1AS25
266117.Rxyl_2892 gi|108805678|ref|YP_645615.1| NYSGXRC-9412a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]