SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_0805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_0805
Domain Number 1 Region: 67-249
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.39e-24
Family Clp protease, ClpP subunit 0.028
Further Details:      
 
Domain Number 2 Region: 421-485
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000432
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_0805
Sequence length 491
Comment (Ralstonia metallidurans CH34)
Sequence
MAGRLHWKWRGHGIHCGPLPAMTLAPIRDWLARVRWLALGRALGLTLLAISGAHAQSASS
ASTAPAVPPVYVIPIRGAISPASASFAVHGIEQASKHGAQLIVIEMDTPGGLDKSMRDII
QAIIASPVPVATYVYPGGARAASAGTYILYASHIAAMAPGTNLGAASPVAIGIGGPKPEA
GPAPASAPSSAPAAEDTMTRKQMHDASAYIRGLAQLRHRNADWGERAVREAVSLSADEAV
AQHVADLIAADLPVLLRQVDGKRIEAAGAMRTLHTAGAPVVTLEPDWRSRLLAVITDPSV
ALILMMIGIYGLIFEFSTPGMVVPGIAGAICLLLGLFALQMLPVNYAGLALIALGVGCMT
AELFLPTFGALGVGGIIAFAFGAVMLIDTDVPGFGVPLSLIATLSTVSAVFLFGMSMVLL
RARRRPVVSGADALVGSIGVVIDDAPADGWATVHGEQWRIHSAAPLVRGQRVRVTARRGL
VLDVTTAGDPS
Download sequence
Identical sequences Q1LQ85
gi|94309750|ref|YP_582960.1| WP_011515640.1.12480 266264.Rmet_0805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]