SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_4878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_4878
Domain Number 1 Region: 116-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.19e-68
Family D-glucarate dehydratase-like 0.000000378
Further Details:      
 
Domain Number 2 Region: 4-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-32
Family Enolase N-terminal domain-like 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_4878
Sequence length 374
Comment (Ralstonia metallidurans CH34)
Sequence
MTATISSIEAILVDLPTIRAHQLAMATMQQQTLVIVRLRCSDGIEGIGEATTIGGLSYGD
ESPEGIKLTIDTYLAPALVGQDATNVHAAMARLNKVARGNRFAKSALESAMLDAQGKRLD
VPLATLLGGAVRDTLPVLWTLASGDTARDIEEAERFLEERRHNTFKLKIGRRSVREDVAH
VSAIKRALGDRARVTVDVNQAWNEADAATGIAMLEAAGIDLIEQPTPREQRTALARLAAR
FVVPIMADEAVTGPEDAMELARLGAADVFALKIAKSGGIFGMLRTAAVGDAAGIALYGGT
MLEGSVGTIAAAHGFCTLPQLAWGTELFGPLLVKDDIVVERPVFKDFSLHLPQGPGLGLA
IDEDKLAHYRRKSA
Download sequence
Identical sequences Q1LDN6
WP_011519299.1.12480 WP_011519299.1.25839 266264.Rmet_4878 gi|94313800|ref|YP_587009.1| gi|94313800|ref|YP_587009.1|NC_007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]