SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_A0040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_A0040
Domain Number 1 Region: 80-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-91
Family RecA protein-like (ATPase-domain) 0.00000000488
Further Details:      
 
Domain Number 2 Region: 348-463
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 8.11e-54
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000403
Further Details:      
 
Domain Number 3 Region: 8-78
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 6.8e-24
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_A0040
Sequence length 464
Comment (Burkholderia xenovorans LB400)
Sequence
MSTTALVEGKIVQCIGAVIDVEFPRDHMPKIYDALILEGSELTLEVQQQLGDGVVRTICL
GASDGLRRGTTVKNTGKPISVPVGKPTLGRIMDVLGRPIDEAGPINSDVVRGIHQKAPAF
DELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHGGYSVF
AGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEHFRDEGLD
VLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKTGSITSVQAV
YVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTSRQIDPNVIGEEHYSI
TRGVQQTLQRYKELRDIIAILGMDELAPEDKLAVARARKIQRFLSQPFHVAEVFTGSPGK
YVPLKETIRGFKMIVEGECDHLPEQAFYMVGTIDEAFEKAKKIQ
Download sequence
Identical sequences Q13SQ2
WP_011490289.1.38508 WP_011490289.1.45576 266265.Bxe_A0040 gi|91785733|ref|YP_560939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]