SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_A3357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_A3357
Domain Number 1 Region: 123-383
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.11e-57
Family D-glucarate dehydratase-like 0.0000000136
Further Details:      
 
Domain Number 2 Region: 1-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.06e-29
Family Enolase N-terminal domain-like 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_A3357
Sequence length 388
Comment (Burkholderia xenovorans LB400)
Sequence
MRIVEIREKTIPISSPIRNAYIDFSKMTLSLVAVVTDVIRDGKPVVGYGFNSNGRYGQGT
LMRERFIPRILEADPASLVNDAGDNLDPHKIWATMFSNEKPGGHGERSVAIGTIDMAVWD
AVAKIEGLPLFQLLADRYGNGQPDRKIFVYAAGGYYYPGQDHGKLKDEMRSYIDRGYTVV
KKKIGGASLDEDLRRIDSILSVLGDGQKLAVDANGRFDLDTAIQYAKALSQYDLFWYEEP
GDPLDFELQATLRNYYDKPMATGEDLFSMQDARNLIRYGGMRPDRDWLQFDCALSYGLVE
YLRTLEMLHQHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPFGGFPDGVKVEN
GHITMPDLPGIGFEGKADLFAEMQRLSA
Download sequence
Identical sequences Q142W1
gi|91782474|ref|YP_557680.1| 266265.Bxe_A3357 WP_011487366.1.38508 WP_011487366.1.45576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]