SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_A4290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_A4290
Domain Number 1 Region: 731-971
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 2 Region: 27-210
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000118
Family Pyruvate oxidase and decarboxylase Pyr module 0.062
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000486
Family Pyruvate oxidase and decarboxylase PP module 0.038
Further Details:      
 
Weak hits

Sequence:  266265.Bxe_A4290
Domain Number - Region: 623-685
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00998
Family Short-chain ferredoxins 0.059
Further Details:      
 
Domain Number - Region: 275-353
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0471
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_A4290
Sequence length 1195
Comment (Burkholderia xenovorans LB400)
Sequence
MTARLPIDGTPALADYKLSDNLTATRGRIFLTGTQALVRLVLMQRAADKARGMNTAGFIS
GYRGSPLGMVDQQLWKAKKLLAASDIRFLPAINEELGGTAVLGTQRVESDPERTVEGVFA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFALMAWHMPV
VNPSNIADMLEFGLYGWELSRFSGAWVGYKAISETVESGSTVDLDALRTDWAAPQDFEAP
AGGLHNRWPDLPSLTIESRMHAKLDAVRHFARVNSIDKWIAPSPHANVGIVTCGKAHLDL
METLRRLDLTVADLEAAGVRIYKVGLSFPLEMTRIDAFVSGLSEVLVIEEKGPVIEQQIK
DYLYNRTQGTRPIVVGKNAEDGTLLLSSLGELRPSRILPVFANWLAKHKPALDRRERVVD
LVAPQILSNAADSVKRTPYFCSGCPHNTSTKVPDGSIAHAGIGCHFMASWMERDTTGLIQ
MGGEGVDWASHSMFTKTRHVFQNLGDGTYFHSGILAIRQAVAAKATITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHDLFPKGTTFHHRSEMDTVQR
ELRDTDGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINEEVCEGCGDCGVQSNCLSVE
PVETALGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGGKLKKAAGAAFDPAALAARVDALP
LPATHLDAAPYDILVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGAVLSFV
RFAARDEWLNQVRIDTQQADVLLACDMVVGASADALQTVRHGRTRIVVNTHAIPNATFVT
NPDATLHADALLDKMRHAAGAERMSTCDAQALATRFLGDTIGANILMLGYAWQLGLVPVS
FGAMMRAIELNNVAVPMNQLAFSIGRLAAEDPAALESLWQARHQAKQPVRVDTLDELIAH
REGRLQIYGGASYVKRYRALVDAARRAETAADANSERVTRAVATTFYRLLAVKDEYEVAR
LHTDAAFREALEAQFEGVAGKDFGIKFNLAPPTLTRPEPGKNPAKKTFGQWMWPVLGTLA
KFRALRGTPLDPFGRTLERKMERELAGDYETTLQRALAKLGADNLEDVAKLADLHARVRG
YGHVKLANLAGVKRGERDLAARLRIEAATGESVRKSLEEVKGAGQLRGIPVVVAK
Download sequence
Identical sequences Q146N0
WP_011486555.1.38508 WP_011486555.1.45576 266265.Bxe_A4290 gi|91781555|ref|YP_556761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]