SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_B1082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_B1082
Domain Number 1 Region: 61-167,223-278
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.85e-23
Family Crotonase-like 0.083
Further Details:      
 
Domain Number 2 Region: 498-535
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000068
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_B1082
Sequence length 546
Comment (Burkholderia xenovorans LB400)
Sequence
MSTYPRLPFRQSGSRMSLIRGGVVGRLMRGITVLGVLLAFGFASCESTVVDVPLRAAVAP
NSVVVIPVNGAISPASADFIVRSLQRAADERAQLAVLQLDTPGGLDTSMRQIIKAILASP
VPVAAFIAPSGARAASAGTYIVYASHIAAMAPGTNLGAATPIQMGIGAEPPAGGGAPGLP
GIGGGGGSGGSGGSGSGDGDGNSPVKPAASTASAPSGSARALPLDTQSTETRKQVHDAAA
YIRGLAQMRGRNADWAERAVREAVSLPAADALAQHVVDLNARDVPDLLRQLDGRTLVTSA
GNVTLRTANVPVVTLEADWRSHFLAVITDPNVALILLMIGMYGLFFEFANPGFVLPGVVG
AISLLLGLFAMQMMPINYVGLGLIFLGIAFLIGEAFLPSFGSLGFGGVAAFVIGALMLID
TDVPGYGIPLPMIAAVAVFSVLFVLGVSRLALRARRQPVVTGSEALIGSVGVVLDGGLLP
ENAASDAASDVTADGALAGWARVHGERWRVSSTAPVAAGHAVRVTARRGLTLTVVPTEAR
QQGESS
Download sequence
Identical sequences Q13M16
266265.Bxe_B1082 WP_011492187.1.38508 WP_011492187.1.45576 gi|91779015|ref|YP_554223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]