SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_B2486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_B2486
Domain Number 1 Region: 166-276
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.47e-17
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_B2486
Sequence length 294
Comment (Burkholderia xenovorans LB400)
Sequence
MKEWTLSEQNELATILEKDGDTVLNAWVAGQLSGGIRQGVISEAELRESARSFLAVFARA
VKTNYNAQLAGETWDSVRTHLVSLSRERVIQGFSPVETAMFVFSLKEPLFEALRKSLGKN
PEAFGDALWKLTQTLDSLGLITIEAYQASRQQIIERQQQELLDLTTPVVRLWDSVVALPL
IGTLDSERTQVVMESLLDSIVENEAAIAIIDITGVPTVDTLVAQHLLKTVAAARLMGAEC
IISGIRPQIAQTIVHLGVDLGDVVTKATLAEALKIALRRVGMTVTKIATAKQGD
Download sequence
Identical sequences Q13QY4
WP_011490873.1.38508 WP_011490873.1.45576 gi|91777647|ref|YP_552855.1| 266265.Bxe_B2486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]