SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_C0614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_C0614
Domain Number 1 Region: 744-989
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.023
Further Details:      
 
Domain Number 2 Region: 28-223
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.65e-18
Family PFOR Pyr module 0.077
Further Details:      
 
Domain Number 3 Region: 457-644
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000736
Family Pyruvate oxidase and decarboxylase PP module 0.03
Further Details:      
 
Domain Number 4 Region: 277-415
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000247
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_C0614
Sequence length 1192
Comment (Burkholderia xenovorans LB400)
Sequence
MNAPVSPSHAAELAAVTLDDKYTLERGRIYISGTQALVRLPMLQKERDRRAGLNTAGYIS
GYRGSPLGGLDLALWNAKQHLHEHDVVFQPGVNEDLAATAVWGTQQINLWPGARYDGVFG
MWYGKGPGVDRSGDVFRHANSAGTDARGGVLVLAGDDHGAKSSSVAHESEHTLIASGIPV
LYPSSVQEYIDYGLHGWAMSRYSGLWVAMKCVTDVVESTASIDIDPERVQIRVPDDYPLP
DGGLNIRWPDPPLVQETRLLDHKWYAALAYVRANRLNRIVIDAPNPRFGIMTAGKAYLDV
RQALLDLGLDDATCARVGIRVMKVGCVWPLDAQDARRFAQGLEEILVVEEKRQVLEYALK
EELYNWREDVRPKIYGKFDERDNEGGEWSVPRGDWLLPAHHELSPALIAKAIARRLAKAD
LPPEVAARIAGRVAVIEGKERDAAQPRLAAERPPWFCSGCPHNTSTKVPEGSRALAGIGC
HYMAMWMDRRTETFSQMGGEGVAWLGQMHFTGEQHVFVNLGDGTYFHSGSLAIRAAVAAR
ANVTYKILYNDAVAMTGGQPVDGVLSVPQIAFQAVAEGVARVVIVTDEPQKYTSAVRLPE
GVGVHHRDRLDAIQHELRATPGTTLLIYDQTCATEKRRRRKRGTYPDPARRAFINDAVCE
GCGDCSVQSNCLSVEPLDTPLGTKRRINQSSCNKDFSCVKGFCPSFTTAEGAQPRKPSGV
GGAAPLPDFTQLPQPRIEATDRPYGILVAGVGGTGVVTIGGLLGMAAHLERKGVVVLDMA
GLAQKGGAVTSHVQIAPTPAHLHATRIGTGEARLVIGCDAIVSASAEALSKMRRGITRAA
INSGATPTAGFVQNPDWTFPGAQTEQLLRENIGEDCSFVDANQLALTLLGDTIYTNPLLL
GFAWQKGWLPLGYASLTRAIELNGVAVEKNRLAFDWGRFVAQHGADEAARAAGRRDAQQA
IVLRLPETLDALIANHAQWLTDYQNAEYAARYLAMIERIRAKEVALGIGKSLPLTRAVAQ
NLAKLMAYKDEYEVARLYAAPAFMDKLRAQFEGEPGKNYTLSFYFAPPLFARRDEHGHLV
KQRFGPWVLPMLRVLAKLKVTRGTVWDLFGKTAERRTERRLIGEYMALVDQFCVSLTATN
RDVAIRLAQLPAAIRGFGHVKERNLLAVGKQREALMAEYLASGDETGERRAV
Download sequence
Identical sequences Q13HC7
gi|91780655|ref|YP_555862.1| WP_011493768.1.38508 WP_011493768.1.45576 266265.Bxe_C0614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]