SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_1946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_1946
Domain Number 1 Region: 110-376
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.11e-78
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 1-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.73e-34
Family Enolase N-terminal domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_1946
Sequence length 378
Comment (Mesorhizobium BNC1)
Sequence
MKITAVRTHLLDHELATPFASATMRFGRRTHVLVEITCDDGTIGWGECLGPARPNAAIVE
AYAAWLIGADPLETEKIWLTLYNALRDQGQRGLTVTALSGIDIALWDIKGKHFGVPVSTL
LGGRFRDSVRAYATGSFKRDGVDRIADNVAEMVRHRDAGFHAAKLKIGFGPDEDLAVIRA
VREAVGPDMRLMIDANHGYDVLEAISVGRQAAQYGIDWFEEPVIPEQLSAYRAVREGQPI
PVAGGETWHTRWGMREPIETRAVDIIQPDLAGCGGFTEARRIMDMAALHNVRLIPHVWGT
AVHIAAALQFMAAQIPSPPRHAPLEPILEFDRTDNPFRQAIVTRPLDHVAGVVIIPDGPG
LGIEIERDALERYRPKDL
Download sequence
Identical sequences Q11GY6
WP_011581281.1.76240 gi|110634296|ref|YP_674504.1| 266779.Meso_1946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]