SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_2257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_2257
Domain Number 1 Region: 464-567
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.44e-18
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_2257
Sequence length 572
Comment (Mesorhizobium BNC1)
Sequence
MTADIITVPPKPAPSFSELFTPKLVTVLREGYSLASFRADAVAGLTVAIVALPLSMAIAI
ASGATPAQGLYTAIVGGFLVSALGGSRFQIGGPAGAFIVLVAATVQAHGMDGLILAVILS
GLMLMAVGFLRLGTYVKFIPYPVTVGFTAGIAVIIFASQIRDILGLRLGGAEPGPLIEKL
PVLWSGLPTANPATVFLAGATIALIIGFKRLQPRLPGMLIAVAVTGLATVGLGLPVATIG
TAFGGIPSGLPIPALPAFDLEKVQTVLPSAVAFALLGSIESLLSAVVADGMTGRRHRSNC
ELVAQGVANVASGLFGGICVTGTIARTATNVRAGAHGPVAGMLHAVFLLLFVLAAAPLAR
YIPLASLAGVLAVVAWNMVEKHAVLTLLRASRGDAAVLIVTFALTIFRDLTEAIVVGFAL
GSILFIHRMSRMTAIEMRLPFVVEDRADEADGGRAPYDEAAGSDPDVVIYRISGAFFFGA
AASIGSVLDRIADSYRALVIDFSAVPFLDSTAANTIEGLAHKAVRRDVKVYLTGTSHEMR
KDLFAQGVKPPLVHYAGSIEDAVKKARGKHGG
Download sequence
Identical sequences Q11G28
WP_011581589.1.76240 gi|110634604|ref|YP_674812.1| 266779.Meso_2257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]