SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_2736 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266779.Meso_2736
Domain Number - Region: 96-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.034
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_2736
Sequence length 153
Comment (Mesorhizobium BNC1)
Sequence
MLMSFLTDLGPWNWMLLGFILLVLEIILPGVFLLWIGIAAVLTGALSLQLWDVSFWTWQV
QVLVFLALSLVSAFIGKRVTDARREEDTDEPLLNRRAEQLVGRTAALEEPISGGYGRIRL
GDTTWRVTGPDLPAGTRVRVVSARGGDLHVEKE
Download sequence
Identical sequences Q11ER2
WP_011582054.1.76240 266779.Meso_2736 gi|110635070|ref|YP_675278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]