SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_2968 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_2968
Domain Number 1 Region: 118-318
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.52e-50
Family D-glucarate dehydratase-like 0.0000147
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.56e-23
Family Enolase N-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_2968
Sequence length 326
Comment (Mesorhizobium BNC1)
Sequence
MRYMAVRHYALPIRGVFRIARGEKTVSNAVEVTLTEGEESGRAECIPYAHYGESVESVME
QITALRKEVEAGLSIEALQEALPPGAARNALDCAMWSLRSKLSGHAIAEYAGLPRLAPVT
TAFTLSLDTPEAMANAAQRNADLPILKLKLNGRDDIARVEAVRAAAPNARLIADANESWT
PQHLDTHLPRFAELGIELLEQPLPAGRDAALRGLNSPVPLAADETCRSLASLNDIVGKYS
FATIKLDKTGGLTEALALITAARAAGLRIMVGSMVSSSLSVGPGLVIAQFAEFLHLDGPL
LLAEDCEPGYQYHAGRLDPDPHVWPV
Download sequence
Identical sequences Q11E35
NYSGXRC-9498b 266779.Meso_2968 WP_011582281.1.76240 gi|110635297|ref|YP_675505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]