SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_3618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_3618
Domain Number 1 Region: 20-189
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.78e-50
Family TK-like Pyr module 0.0081
Further Details:      
 
Domain Number 2 Region: 195-331
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.01e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_3618
Sequence length 331
Comment (Mesorhizobium BNC1)
Sequence
MSGTSTIAKNAAPVIAASSIDEGHRTKPIPFGNALIELARTRPEIVGMSADLAKYTDMHI
FAEAYPDRFYQMGMSEQLMATAAGGLAKEGFIPFATTYATFASRRCYDFMSQAVAEQDAS
VKLIGGLPGLTTGYGPSHQATDDIAIFRAMPNMVVIDPCDAHEIEQMVPAIADYDGPVYS
RILRGNVAVVLDEYDYRFELGKAALLRGGRDVLIISTGFMTMRALDSAKELQADGIDVAV
LHVPTIKPLDEMTILREAKRTGRLIVTAENHSCVGGLGEAVASCLSMNGVSAEMRRIALP
DRFLAAGTLEVLQERYGITRAAVSRNIRRWL
Download sequence
Identical sequences Q11C88
266779.Meso_3618 gi|110635944|ref|YP_676152.1| WP_011582928.1.76240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]