SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SM_b20361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SM_b20361
Domain Number 1 Region: 26-222
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.54e-27
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Weak hits

Sequence:  266834.SM_b20361
Domain Number - Region: 226-259
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0604
Family PhnA zinc-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266834.SM_b20361
Sequence length 265
Comment (Sinorhizobium meliloti)
Sequence
MDMTDQPRAHSKLNSTRLALQRLERGRDPWALRWQALLAVIDLSILAFFILGPYLRAGPS
YLIIDYIIAAWIGCELIARAFAAPSIERFLRRPMTWVDVIILGTLLFPDLLFNFAFLRVM
RIWAIGKSPLLLEGLRRAGWSHLQDVFRACLNFLVFLFVVTGFVYTTFFYHREGGEGFVD
ALYFTVATITTTGFGDITLPGTLGKLTSVITMIVGISLFVRLAQAVVRPYKVSFPCPQCG
LQRHDTDAVHCKACGHLLNIPDEGD
Download sequence
Identical sequences Q92WJ2
gi|334319770|ref|YP_004556399.1| gi|16264095|ref|NP_436887.1|NC_003078 266834.SM_b20361 gi|16264095|ref|NP_436887.1| NP_436887.1.96377 WP_010975239.1.18618 WP_010975239.1.22199 WP_010975239.1.24285 WP_010975239.1.36292 WP_010975239.1.4234 WP_010975239.1.44594 WP_010975239.1.47143 WP_010975239.1.58608 WP_010975239.1.65778 WP_010975239.1.66997 WP_010975239.1.72343 WP_010975239.1.73540 WP_010975239.1.78492 WP_010975239.1.787 WP_010975239.1.79107 WP_010975239.1.83536 WP_010975239.1.89614 WP_010975239.1.90561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]