SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SM_b20990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SM_b20990
Domain Number 1 Region: 23-228
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.21e-23
Family Clp protease, ClpP subunit 0.057
Further Details:      
 
Domain Number 2 Region: 404-467
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000017
Family NfeD domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266834.SM_b20990
Sequence length 478
Comment (Sinorhizobium meliloti)
Sequence
MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVPGAERTALVLHVNGAISPAA
AEYVTRGLQQARDRGAALVVLQMDTPGGLDTSMRDIIRAILDSPVPVASFVSPSGARAAS
AGTYILYASHIAAMAPGTNLGAATPIAIGGGLFGNDEQEGEEKPGDPDKPEPRKPANAGE
AKLINDAVAYIRGLAELRNRNVDWAERAVREAASLSSAAAAREQVIDFTAVSVDDLLKQA
HGRAVRIGQSDVRLDTSGLAIEDLPPDWRTRLLSVITNPNVALLLMMVGIYGLIFEFLAP
GTVVPGTIGGISLLLGLYALAVLPVSYAGVGLILLGAGLLVAEAHAPSFGVLGLGGTVAL
VLGAAILFDTDMPGLQVSWPALSGIAIASLAFSLLVARLALVSRRHKVATGAEEMIGISG
KVDSWAGADGYVIAHGERWRAVSSESLGPGEDVMVVGREGLTLKVARNAAPGGDGDRS
Download sequence
Identical sequences Q92UL2
NP_437655.1.96377 WP_010975947.1.18618 WP_010975947.1.58221 gi|16264863|ref|NP_437655.1| gi|16264863|ref|NP_437655.1|NC_003078 266834.SM_b20990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]