SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SMa1461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SMa1461
Domain Number 1 Region: 116-365
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.24e-59
Family D-glucarate dehydratase-like 0.00054
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.93e-26
Family Enolase N-terminal domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266834.SMa1461
Sequence length 374
Comment (Sinorhizobium meliloti)
Sequence
MVKISNVRVRPLVLPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPDQTGTAA
ILYRLAKHLVGHSPHDVAPLIARIFHQEYLGHGANIMRAANQIFSGIDMAMWDLQGKLAG
LPVHQLLGGAHRKAVGYFYFLQGETAEELARDAAVGHAQGERVFYLKVGRGEKLDLEITA
AVRGEIGDARLRLDANEGWSVHDAINMCRKLEKYDIEFIEQPTVSWSIPAMAHVREKVGI
PIVADQAAFTLYDVYEICRQRAADMICIGPREIGGIQPMMKAAAVAEAAGLKICIHSSFT
TGITTCAEHHIGLAIPNLDDGNQIMWQLVQEDIVSSPDLTPKNGWLDAFRKPGLGFQLAE
DLVAEGEGRYAASR
Download sequence
Identical sequences A0A0E0ULC7 Q92YR6
gi|16263250|ref|NP_436043.1| 266834.SMa1461 gi|384532590|ref|YP_005718194.1| NP_436043.1.96377 WP_010967767.1.3038 WP_010967767.1.36834 WP_010967767.1.4234 WP_010967767.1.58221 WP_010967767.1.58608 WP_010967767.1.63001 WP_010967767.1.65778 WP_010967767.1.787 WP_010967767.1.92524 WP_010967767.1.94084 WP_010967767.1.96031 gi|16263250|ref|NP_436043.1|NC_003037 gi|384532590|ref|YP_005718194.1|NC_017324 gi|407691039|ref|YP_006814623.1|NC_018683 gi|433616104|ref|YP_007192899.1|NC_019848 gi|470184784|ref|YP_007572757.1|NC_020527 gi|407691039|ref|YP_006814623.1| NYSGXRC-9387a gi|433616104|ref|YP_007192899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]