SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SMc01028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SMc01028
Domain Number 1 Region: 137-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.68e-125
Family Enolase 0.0000000247
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.85e-55
Family Enolase N-terminal domain-like 0.00000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266834.SMc01028
Sequence length 424
Comment (Sinorhizobium meliloti)
Sequence
MTAIIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLG
KGVERAVDAVNGEIFEAIGGLDAENQIQIDRTMIELDGTPNKSRLGANAILGVSLAVAKA
AAEASGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRM
GSEVFHTLKKQLAADGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYKPGEDMYVAL
DCASTEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIISIEDGMAEDDWDGWKSLTD
LVGNKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTA
VMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGPQAQYAGRS
VLRG
Download sequence
Identical sequences A0A0E0UBI1 A0A222GZ46 F7X1L1 Q92Q98
gi|384536563|ref|YP_005720648.1| gi|384529156|ref|YP_005713244.1| 266834.SMc01028 gi|470188396|ref|YP_007574707.1| gi|15965196|ref|NP_385549.1| NP_385549.1.96377 WP_010969226.1.11889 WP_010969226.1.18618 WP_010969226.1.21755 WP_010969226.1.22199 WP_010969226.1.24285 WP_010969226.1.30341 WP_010969226.1.36091 WP_010969226.1.36834 WP_010969226.1.4234 WP_010969226.1.47143 WP_010969226.1.48083 WP_010969226.1.49828 WP_010969226.1.50755 WP_010969226.1.54190 WP_010969226.1.55094 WP_010969226.1.58221 WP_010969226.1.58608 WP_010969226.1.63001 WP_010969226.1.72343 WP_010969226.1.73540 WP_010969226.1.787 WP_010969226.1.80755 WP_010969226.1.83096 WP_010969226.1.83536 WP_010969226.1.86220 WP_010969226.1.89614 WP_010969226.1.90561 WP_010969226.1.94084 WP_010969226.1.99158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]