SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SMc03005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SMc03005
Domain Number 1 Region: 11-87
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000216
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266834.SMc03005
Sequence length 97
Comment (Sinorhizobium meliloti)
Sequence
MASRNSARNTLMLAPVLDLNEATVLHERLLALKGGAVAIDASAVERVGTLCVQVLMAAAR
SWEADRLSFTFAEVSDAFIKTTQLIGADIGPLMAKEI
Download sequence
Identical sequences A0A0E0U959 A0A222GER2 A0A2G7TKE0 Q92S05
gi|15964390|ref|NP_384743.1| gi|470187591|ref|YP_007573902.1| gi|433612396|ref|YP_007189194.1| 266834.SMc03005 gi|407719462|ref|YP_006839124.1| NP_384743.1.96377 WP_010968719.1.18618 WP_010968719.1.22199 WP_010968719.1.3038 WP_010968719.1.3110 WP_010968719.1.32135 WP_010968719.1.34728 WP_010968719.1.36292 WP_010968719.1.36834 WP_010968719.1.4234 WP_010968719.1.44594 WP_010968719.1.58221 WP_010968719.1.58608 WP_010968719.1.63001 WP_010968719.1.65778 WP_010968719.1.72343 WP_010968719.1.73540 WP_010968719.1.787 WP_010968719.1.79107 WP_010968719.1.83536 WP_010968719.1.86220 WP_010968719.1.90968 WP_010968719.1.92524 WP_010968719.1.94084 WP_010968719.1.96031 gi|384528342|ref|YP_005712430.1| gi|334315091|ref|YP_004547710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]