SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SMc04021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266834.SMc04021
Domain Number - Region: 94-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00196
Family NfeD domain-like 0.012
Further Details:      
 
Domain Number - Region: 30-87
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family Glycerol-3-phosphate transporter 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266834.SMc04021
Sequence length 151
Comment (Sinorhizobium meliloti)
Sequence
MITRIILELGPWSWWVLGLLLLAAELILPGVFLVWIALAALVTGALSLFFWEAPFWSWQV
QFVAFALLSVASVLIGRRFVSSSAESDEPLLNRRGESLVGRTAVLEQPIAEGRGRVRLDD
TTWSVEGPDLPVGARVRIVASSGRHLTVEQI
Download sequence
Identical sequences A0A0E0UGI2 A0A222H385 F7X8F1 H0G331 Q92M50
266834.SMc04021 gi|15966558|ref|NP_386911.1| gi|470189770|ref|YP_007576081.1| gi|407721872|ref|YP_006841534.1| gi|384530688|ref|YP_005714776.1| gi|433614636|ref|YP_007191434.1| gi|384537391|ref|YP_005721476.1| NP_386911.1.96377 WP_003531117.1.18618 WP_003531117.1.21755 WP_003531117.1.22199 WP_003531117.1.24285 WP_003531117.1.30341 WP_003531117.1.3038 WP_003531117.1.3110 WP_003531117.1.32135 WP_003531117.1.34728 WP_003531117.1.36091 WP_003531117.1.36292 WP_003531117.1.36834 WP_003531117.1.4234 WP_003531117.1.44594 WP_003531117.1.47143 WP_003531117.1.48083 WP_003531117.1.49828 WP_003531117.1.50755 WP_003531117.1.55094 WP_003531117.1.58221 WP_003531117.1.58608 WP_003531117.1.63001 WP_003531117.1.72343 WP_003531117.1.73540 WP_003531117.1.787 WP_003531117.1.79107 WP_003531117.1.80755 WP_003531117.1.83536 WP_003531117.1.86220 WP_003531117.1.89614 WP_003531117.1.90561 WP_003531117.1.90968 WP_003531117.1.92524 WP_003531117.1.94084 WP_003531117.1.96031 WP_003531117.1.99158 gi|334317562|ref|YP_004550181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]