SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mll0853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll0853
Domain Number 1 Region: 66-291
Classification Level Classification E-value
Superfamily MetI-like 3.14e-64
Family MetI-like 0.000039
Further Details:      
 
Weak hits

Sequence:  266835.mll0853
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.00196
Family MalF N-terminal region-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.mll0853
Sequence length 307
Comment (Mesorhizobium loti)
Sequence
MTYAVSEIRSAGKPRRKRLSHAAIEPWLYLSPSIILLVVVLLVPLVIGISYSFRKFSAFK
SEFVGLGQYRAMLSDPVLGQALVNTLWWTVASLFFQFFLGLGLALLLDKPFRGRKLVQAL
VFLPWAVPSFLSGLTWAWLFNPIIGPLPHWLFALGLKAEPTNILSDPATAMWGPIVANVW
FGIPFFAITLLAALKSIPSELHEAAAIDGASPWQRFTKVTLPFLAPTIAITVMLRTIWIA
TFADLIFVMTEGGPAGSTNTVPVYIYVSAFKSLDKGYASAVAVLLLVLLIAYAIALIAIR
RSLVRHV
Download sequence
Identical sequences A0A1A5HQ43 Q98LW1
266835.mll0853 WP_010909706.1.100680 WP_010909706.1.29505 WP_010909706.1.29585 WP_010909706.1.45716 WP_010909706.1.62138 WP_010909706.1.7437 WP_010909706.1.86590 gi|13470997|ref|NP_102566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]