SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266835.mll1933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll1933
Domain Number 1 Region: 33-135,169-227
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.58e-22
Family Crotonase-like 0.056
Further Details:      
 
Domain Number 2 Region: 401-464
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000994
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266835.mll1933
Sequence length 473
Comment (Mesorhizobium loti)
Sequence
MSFARVALLAAAFVAVAAFSPLSSAGSEKVALSVAIDGAIGPASTRQLEEALDVAAKRDA
TVLILQLDTPGGLVTSMREMIADILASPVPVIGYVAPAGGHAASAGTYILYATHVAAMAP
GTNLGAATPVEIGGLPSLPGGDKGDQKTQGEQKTQGDQKNQGDQKGEDGRPAGDAMMAKV
TNDAVALIRSLAELRGRNGDWGEKAVREAASLSANAALQEHVIDFVAHDTTELLQLADGR
TVDVAGKKVVLATKGLPVETLEPGWFIRLLAVITDPNIAVILMLVGVYGIVFEFTSPGAV
APGVIGTICLVLGLYALDLLPINYTGLALMLLGIAFLVIEALNPTVVLGVSGVAAFLFGA
AMLLRVEGPGFAMSWAVIGPAAALTLGLALLTGTYVWAARKNPPRVGGDAMRGLPVEILD
WQGGEGHVLALGERWRAKAAEPIVAGDSVEVTDISDLVLTVRRRDPGRNGARQ
Download sequence
Identical sequences Q98JI0
WP_010910537.1.45716 266835.mll1933 gi|13471832|ref|NP_103399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]