SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mll6237 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll6237
Domain Number 1 Region: 54-171
Classification Level Classification E-value
Superfamily Folate-binding domain 0.0000000000000188
Family Aminomethyltransferase folate-binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266835.mll6237
Sequence length 174
Comment (Mesorhizobium loti)
Sequence
MSEFDLIHRPAISTEPLQGSDAFAMKALPEGAIVHVLAAPREQDLASFLVGLGKGHVHAV
SPGQWFIVGDEPMTYSSMKALFEMLEPRATGVDQSGGRVRIRIDGRQSERILSTGTAIDL
SAESFRVGQSATTLIGHIAAHITRIGSDSFELIVLRSFAESLWDDLTRVSAGFR
Download sequence
Identical sequences Q989Y3
WP_010913880.1.45716 gi|13475211|ref|NP_106775.1| 266835.mll6237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]