SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266835.mll9372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll9372
Domain Number 1 Region: 103-377
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.59e-70
Family D-glucarate dehydratase-like 0.0000189
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.46e-28
Family Enolase N-terminal domain-like 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266835.mll9372
Sequence length 382
Comment (Mesorhizobium loti)
Sequence
MKITGVNIYLLKSGRLHPVLVEISTDEGITGAGEAGIAYGVGGTAAAGMIKDLSERFLIG
KDPSRIEELWSTMYDHSFWAKNGGAIIFAGISAIEQALWDIKGKCLGVPVYELFGGKIRD
RVRAYANGWYGAADTPDEFARAVERPLKEGYGALKFYPLAQRVGSALQHVTRRSMSAEAI
ELAYRRVKAVRDAAGPEIELMVDLSGGLTTDETIRFCRKIGELDICFVEEPCDPFDNGAL
KVISEQIPLPIAVGERVYTRFGFRKIFELQACGIIQPDIGTAGGLMETKKICAMAEAYNM
RVAPHVCGSSLIETATLQLEANITNFMIHEHYPAFKADDGYVEVLENPPSISSGYFEMPN
GPGLGAVLIKRNIEPYLWASCT
Download sequence
Identical sequences A0A1B4YZW9 Q981H6
gi|13488170|ref|NP_085892.1|NC_002679 NYSGXRC-9283a 266835.mll9372 gi|13488170|ref|NP_085892.1| WP_010915929.1.45716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]